keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
Exendin-4 peptide derivative acetate is the salt form of Exendin-4 peptide derivative.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
1 mg | Inquiry | $ 274.00 | |
5 mg | Inquiry | $ 981.00 | |
10 mg | Inquiry | $ 1,485.00 |
Description | Exendin-4 peptide derivative acetate is the salt form of Exendin-4 peptide derivative. |
Synonyms | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS, Exendin-4 peptide derivative |
Molecular Weight | N/A |
CAS No. | TP1154 |
keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
You can also refer to dose conversion for different animals. More
bottom
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc.
Exendin-4 peptide derivative acetate TP1154 Exendin-4 peptide derivative Acetate GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Exendin 4 peptide derivative acetate Exendin4 peptide derivative acetate Exendin-4 peptide derivative inhibitor inhibit