Shopping Cart
- Remove All
![TargetMol](https://newstatic.targetmol.com/error/oops.webp)
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $515 | 20 days | |
100 μg | $833 | 20 days | |
1 mg | $2,450 | 20 days |
Description | Adiponectin Protein, Feline, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 24.9 kDa and the accession number is A4PB30. |
Species | Feline |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | A4PB30 |
Synonyms | apM-1,30 kDa adipocyte complement-related protein,APM1,ACRP30,Adipocyte, C1q and collagen domain-containing protein,Adipocyte complement-related 30 kDa protein,Adipose most abundant gene transcript 1 protein,ADIPOQ |
Amino Acid | QDSETEGPGVVVPLPKGACTGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGVTGIEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLESRVTVPNVPIRFTKIFYNQQNHYDVTTRKFHCNIPGLYYFSYHITVYLKDVKVSLYKRDKAMLFTYDQYQEKNVDQASGSVLLHLETGDEVWLQVYGDGDYNGLYADNVNDSTFTGFLLYYDTV |
Construction | 18-244 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 24.9 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.