Shopping Cart
- Remove All
![TargetMol](https://newstatic.targetmol.com/error/oops.webp)
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $397 | 20 days | |
100 μg | $769 | 20 days | |
500 μg | $1,780 | 20 days |
Description | Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. 3-dehydroquinase Protein, Salmonella typhi, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.6 kDa and the accession number is P24670. |
Species | Salmonella typhi |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis |
Accession Number | P24670 |
Synonyms | aroD,DHQ1,3-dehydroquinase,Type I DHQase,3-dehydroquinate dehydratase,Type I dehydroquinase |
Amino Acid | MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA |
Construction | 1-252 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 29.6 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.