Agn1 Protein, S. pombe, Recombinant (His & Myc)

Catalog No. TMPH-03484

Has a role in cell separation where it is required for the degradation of the cell wall material surrounding the septum (the septum edging) which must be hydrolyzed before full separation of the daughter cells can occur. Hydrolyzes 1,3-alpha-glucan predominantly into pentasaccharides. Agn1 Protein, S. pombe, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 51.8 kDa and the accession number is O13716.

Agn1 Protein, S. pombe, Recombinant (His & Myc)

Catalog No. TMPH-03484

Pack Size	Price	Availability
20 μg	$284	20 days
100 μg	$537	20 days
1 mg	$2,300	20 days

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Has a role in cell separation where it is required for the degradation of the cell wall material surrounding the septum (the septum edging) which must be hydrolyzed before full separation of the daughter cells can occur. Hydrolyzes 1,3-alpha-glucan predominantly into pentasaccharides. Agn1 Protein, S. pombe, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 51.8 kDa and the accession number is O13716.
Species	Fission yeast
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	O13716
Synonyms	Glucan endo-1,3-alpha-glucosidase agn1,Endo-1,3-alpha-glucanase agn1
Amino Acid	DKMVVAHFIVGNTYPYTVSNWEEDIQDAIAVGIDGFALNMGSDAWQVERIEDAYDAAASVSSDFKLFISFDMSIISADADFIEGVVRRFADKPNQLYYDGKVFVSTFAGETDTFGYSDVSTGWDSAVKEPLASAGYPIYFVPSWTSLGQGALEESVADGFLSWNAWPTTDADMNDNDDIGYQNLANSLGKLYVAPVSPWFYTHLSYKNWAYKSDWLIIDRWNEMLSVQPDMIEVLTWNDYGESHYIGNIQGALPAGSEGYVDGFDHTAWRYLMSPYISAYKLGLSEPYINFESLFYWYRPTPKSATATADSLSYPSGGDYMEDEIFVLVYLLQSAEVTVTCGSTTQTFSGVPGVNQFTIPMETNASPSFTVARQGGTLASGTGPEIVDSLSIYNFNAYTGVLYF
Construction	21-424 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	51.8 kDa (predicted)
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Has a role in cell separation where it is required for the degradation of the cell wall material surrounding the septum (the septum edging) which must be hydrolyzed before full separation of the daughter cells can occur. Hydrolyzes 1,3-alpha-glucan predominantly into pentasaccharides.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.