Shopping Cart
- Remove All
Your shopping cart is currently empty
Angiogenin-4 Protein, Mouse, Recombinant (His & SUMOstar)
Catalog No. TMPH-02508
Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). Angiogenin-4 Protein, Mouse, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 29.9 kDa and the accession number is Q3TMQ6.
Angiogenin-4 Protein, Mouse, Recombinant (His & SUMOstar)
Catalog No. TMPH-02508
Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). Angiogenin-4 Protein, Mouse, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 29.9 kDa and the accession number is Q3TMQ6.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $284 | 20 days | |
| 100 μg | $536 | 20 days | |
| 500 μg | $1,480 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). Angiogenin-4 Protein, Mouse, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 29.9 kDa and the accession number is Q3TMQ6. |
| Species | Mouse |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis-SUMOstar |
| Accession Number | Q3TMQ6 |
| Synonyms | EC:3.1.27.-,Angiogenin-4,Ang4 |
| Amino Acid | QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP |
| Construction | 25-144 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 29.9 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.