Shopping Cart
- Remove All
- Your shopping cart is currently empty
Bovine coronavirus (strain 98TXSF-110-LUN) Spike glycoprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 37.3 kDa and the accession number is Q8V436.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $368 | 20 days | |
100 μg | $987 | 20 days | |
1 mg | $4,340 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Bovine coronavirus (strain 98TXSF-110-LUN) Spike glycoprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 37.3 kDa and the accession number is Q8V436. |
Species | BCoV |
Expression System | HEK293 Cells |
Tag | C-6xHis |
Accession Number | Q8V436 |
Synonyms | Spike glycoprotein,S glycoprotein,S,Peplomer protein,E2 |
Amino Acid | TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKTSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDHCGGNPCTCQPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY |
Construction | 314-634 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 37.3 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.