Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

Potent and specific inhibitor of CaM-kinase II (CAMK2). CAMK2N1 Protein, Human, Recombinant (His & Trx) is expressed in E. coli expression system with N-6xHis-Trx tag. The predicted molecular weight is 25.6 kDa and the accession number is Q7Z7J9.

Human

E. coli

CaMKIIN-alpha,CaMKII inhibitory protein alpha,CAMK2N1,Calcium/calmodulin-dependent protein kinase II inhibitor 1

MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV

1-78 aa

> 85% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Potent and specific inhibitor of CaM-kinase II (CAMK2).