Shopping Cart
- Remove All
![TargetMol](https://newstatic.targetmol.com/error/oops.webp)
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 μg | $78 | 20 days | |
50 μg | $198 | 20 days | |
100 μg | $353 | 20 days | |
200 μg | $581 | 20 days | |
500 μg | $978 | 20 days | |
1 mg | $1,560 | 20 days |
Description | Polymerizes chitin, a structural polymer of the cell wall and septum, by transferring the sugar moiety of UDP-GlcNAc to the non-reducing end of the growing chitin polymer. Required for mitotic division septum formation during adverse conditions. CHS1 Protein, S. cerevisiae, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.6 kDa and the accession number is P08004. |
Species | Saccharomyces cerevisiae |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | P08004 |
Synonyms | CHS1,Chitin-UDP acetyl-glucosaminyl transferase 1,Chitin synthase 1 |
Amino Acid | QNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQSLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQQLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTSPSIASSSDGYADQEARPILE |
Construction | 4-200 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 26.6 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Polymerizes chitin, a structural polymer of the cell wall and septum, by transferring the sugar moiety of UDP-GlcNAc to the non-reducing end of the growing chitin polymer. Required for mitotic division septum formation during adverse conditions. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.