Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

Claudin-3 Protein, Human, Recombinant (B2M & His) is expressed in E. coli.

Human

E. coli

Rat ventral prostate.1 protein homolog,hRVP1,CPETR2,CPE-receptor 2,CPE-R 2,Clostridium perfringens enterotoxin receptor 2,CLDN3,Claudin-3,C7orf1

RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR

30-80 aa

> 90% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.