Fully biologically active when compared to standard. The biological activity is determined by its ability to enhance neurite outgrowth of E16­E18 rat embryonic cortical neurons. rHuTAFA­2, immobilized at 6­24 μg/mL on a 96 well plate, is able to significantly enhance neurite outgrowth.

FAM19A2 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8N3H0.

Human

E. coli

ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

31-131 aa

>95% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.