Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

IFI27L2A Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02733

May be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors. Through the regulation of NR4A1 transcriptional activity, may play a role in the vascular response to injury. IFI27L2A Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 7.3 kDa and the accession number is Q8R412.

IFI27L2A Protein, Mouse, Recombinant (His)

IFI27L2A Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02733
May be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors. Through the regulation of NR4A1 transcriptional activity, may play a role in the vascular response to injury. IFI27L2A Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 7.3 kDa and the accession number is Q8R412.
Pack SizePriceAvailabilityQuantity
20 μg $1,50020 days
100 μg $2,75020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
May be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors. Through the regulation of NR4A1 transcriptional activity, may play a role in the vascular response to injury. IFI27L2A Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 7.3 kDa and the accession number is Q8R412.
Species
Mouse
Expression System
E. coli
TagN-10xHis
Accession NumberQ8R412
Synonyms
Isg12,Interferon-stimulated gene 12 protein (ISG12),Interferon alpha-inducible protein 27-like protein 2A,Ifi27l2a,Ifi27
Amino Acid
AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL
Construction
25-90 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight7.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
May be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors. Through the regulation of NR4A1 transcriptional activity, may play a role in the vascular response to injury.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords