Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/mL can bind MSLN, the EC 50 is 460.7-662.2 ng/mL.

Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Mucin-16/MUC16 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 30.5 kDa and the accession number is Q8WXI7.

Human

HEK293 Cells

Ovarian carcinoma antigen CA125,Ovarian cancer-related tumor marker CA125,MUC16,Mucin-16

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM

12660-12923 aa

> 95% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.