Shopping Cart
- Remove All
- Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $154 | 20 days | |
100 μg | $371 | 20 days |
Biological Information | Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/mL can bind MSLN, the EC 50 is 460.7-662.2 ng/mL. |
Description | Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Mucin-16/MUC16 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 30.5 kDa and the accession number is Q8WXI7. |
Species | Human |
Expression System | HEK293 Cells |
Tag | C-6xHis |
Accession Number | Q8WXI7 |
Synonyms | Ovarian carcinoma antigen CA125,Ovarian cancer-related tumor marker CA125,MUC16,Mucin-16 |
Amino Acid | GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM |
Construction | 12660-12923 aa |
Protein Purity | > 95% as determined by SDS-PAGE. |
Molecular Weight | 30.5 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.