Shopping Cart
- Remove All
- Your shopping cart is currently empty
Receptor for neuropeptide Y and peptide YY. NPY2R Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 11.0 kDa and the accession number is P97295.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $678 | 20 days | |
1 mg | $2,300 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Receptor for neuropeptide Y and peptide YY. NPY2R Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 11.0 kDa and the accession number is P97295. |
Species | Mouse |
Expression System | E. coli |
Tag | N-10xHis |
Accession Number | P97295 |
Synonyms | NPY-Y2 receptor,Npy2r,Neuropeptide Y receptor type 2 |
Amino Acid | MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV |
Construction | 1-51 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 11.0 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Receptor for neuropeptide Y and peptide YY. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.