Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

PSMD14 Protein, Human, Recombinant (His & MBP)

Catalog No. TMPH-00849

PSMD14 Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus insect cells with N-MBP and C-6xHis tag. The predicted molecular weight is 79.2 kDa and the accession number is O00487.

PSMD14 Protein, Human, Recombinant (His & MBP)

PSMD14 Protein, Human, Recombinant (His & MBP)

Catalog No. TMPH-00849
PSMD14 Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus insect cells with N-MBP and C-6xHis tag. The predicted molecular weight is 79.2 kDa and the accession number is O00487.
Pack SizePriceAvailabilityQuantity
20 μg$49120 days
100 μg$1,37020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
PSMD14 Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus insect cells with N-MBP and C-6xHis tag. The predicted molecular weight is 79.2 kDa and the accession number is O00487.
Species
Human
Expression System
Baculovirus Insect Cells
TagN-MBP, C-6xHis
Accession NumberO00487
Synonyms
PSMD14,26S proteasome-associated PAD1 homolog 1,26S proteasome regulatory subunit RPN11,26S proteasome non-ATPase regulatory subunit 14
Amino Acid
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Construction
1-310 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight79.2 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. The PSMD14 subunit is a metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains within the complex. Plays a role in response to double-strand breaks (DSBs): acts as a regulator of non-homologous end joining (NHEJ) by cleaving 'Lys-63'-linked polyubiquitin, thereby promoting retention of JMJD2A/KDM4A on chromatin and restricting TP53BP1 accumulation. Also involved in homologous recombination repair by promoting RAD51 loading.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.