Shopping Cart
- Remove All
Your shopping cart is currently empty
SFRP5 Protein, Mouse, Recombinant (His)
Catalog No. TMPH-02888
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP5 may be involved in determining the polarity of photoreceptor, and perhaps, other cells in the retina. SFRP5 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 37.2 kDa and the accession number is Q9WU66.
SFRP5 Protein, Mouse, Recombinant (His)
Catalog No. TMPH-02888
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP5 may be involved in determining the polarity of photoreceptor, and perhaps, other cells in the retina. SFRP5 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 37.2 kDa and the accession number is Q9WU66.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $284 | 20 days | |
| 100 μg | $537 | 20 days | |
| 1 mg | $2,300 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP5 may be involved in determining the polarity of photoreceptor, and perhaps, other cells in the retina. SFRP5 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 37.2 kDa and the accession number is Q9WU66. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q9WU66 |
| Synonyms | Sfrp5,Secreted frizzled-related protein 5 |
| Amino Acid | APTRGQEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDNLTGSFLVMGRKVEGQLLLTAVYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH |
| Construction | 22-314 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 37.2 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP5 may be involved in determining the polarity of photoreceptor, and perhaps, other cells in the retina. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.