Shopping Cart
- Remove All
Your shopping cart is currently empty
SFTPB Protein, Human, Recombinant
Catalog No. TMPH-01979
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988.
SFTPB Protein, Human, Recombinant
Catalog No. TMPH-01979
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $439 | 20 days | |
| 100 μg | $691 | 20 days | |
| 500 μg | $1,640 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | Tag Free |
| Accession Number | P07988 |
| Synonyms | SFTPB,Pulmonary surfactant-associated proteolipid SPL(Phe),Pulmonary surfactant-associated protein B,6 kDa protein,18 kDa pulmonary-surfactant protein |
| Amino Acid | FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM |
| Construction | 201-279 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 8.7 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.