Shopping Cart
- Remove All
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $397 | 20 days | |
100 μg | $769 | 20 days | |
1 mg | $2,760 | 20 days |
Description | Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate. Involved in the regulation of retinal hyaloid vessel regression during postnatal development. May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas. SLC17A6 Protein, Rat, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is Q9JI12. |
Species | Rat |
Expression System | P. pastoris (Yeast) |
Tag | C-6xHis |
Accession Number | Q9JI12 |
Synonyms | Slc17a6,Vesicular glutamate transporter 2,Solute carrier family 17 member 6,Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter,Differentiation-associated BNPI |
Amino Acid | SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS |
Construction | 499-582 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 11.1 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate. Involved in the regulation of retinal hyaloid vessel regression during postnatal development. May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.