Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SLURP2 Protein, Human, Recombinant (His)

Catalog No. TMPH-02066

SLURP2 Protein, Human, Recombinant (His) is expressed in Yeast.

SLURP2 Protein, Human, Recombinant (His)

SLURP2 Protein, Human, Recombinant (His)

Catalog No. TMPH-02066
SLURP2 Protein, Human, Recombinant (His) is expressed in Yeast.
Pack SizePriceAvailabilityQuantity
20 μg$34120 days
100 μg$64620 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
SLURP2 Protein, Human, Recombinant (His) is expressed in Yeast.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP0DP57
Synonyms
SLURP2,Secreted Ly-6/uPAR-related protein 2,Secreted Ly-6/uPAR domain-containing protein 2,Secreted LY6/PLAUR domain-containing protein 2
Amino Acid
IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
Construction
23-97 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight10.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3:beta-2-containing nAChRs and strongly these of alpha-4:beta-2-containing nAChRs, modulates alpha-7-containing nAChRs, and inhibits nicotine-induced signaling probably implicating alpha-3:beta-4-containing nAChRs. Proposed to act on alpha-3:beta-2 and alpha-7 nAChRs in an orthosteric, and on mAChRs, such as CHRM1 and CHRM3, in an allosteric manner.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.