Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

VRK1 Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02899

VRK1 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-6xHis and C-Myc tag. The predicted molecular weight is 55.2 kDa and the accession number is Q80X41.

VRK1 Protein, Mouse, Recombinant (His & Myc)

VRK1 Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02899
VRK1 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-6xHis and C-Myc tag. The predicted molecular weight is 55.2 kDa and the accession number is Q80X41.
Pack SizePriceAvailabilityQuantity
20 μg $28420 days
100 μg $59020 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
VRK1 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-6xHis and C-Myc tag. The predicted molecular weight is 55.2 kDa and the accession number is Q80X41.
Species
Mouse
Expression System
E. coli
TagN-6xHis, C-Myc
Accession NumberQ80X41
Synonyms
Vrk1,Vaccinia-related kinase 1,Serine/threonine-protein kinase VRK1,Serine/threonine-protein kinase 51PK
Amino Acid
MPRVKAAQAGRPGPAKRRLAEQFAAGEVLTDMSRKEWKLGLPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTHKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLSHKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHDGTLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEKCFPEKNKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKKEAEESAVCAVEDMECSDTQVQEAAQTRSVESQGAIHGSMSQPAAGCSSSDSSRRQQHLGLEQDMLRLDRRGSRTRKKAQK
Construction
1-440 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight55.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.