Shopping Cart
- Remove All
Your shopping cart is currently empty
S27 protein acetate
🥰Excellent
Catalog No. TP2516
Alias LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFR
S27 protein acetate is a polypeptide encoded by the MRPS27 gene.
S27 protein acetate
S27 protein acetate
🥰Excellent
Catalog No. TP2516Alias LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFR
S27 protein acetate is a polypeptide encoded by the MRPS27 gene.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $195 | In Stock | |
| 5 mg | $483 | In Stock | |
| 10 mg | $692 | In Stock | |
| 25 mg | $1,080 | In Stock | |
| 50 mg | $1,490 | In Stock | |
| 100 mg | $1,970 | In Stock |
Bulk & Custom
Add to Cart
Questions
View MoreContact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
| Description | S27 protein acetate is a polypeptide encoded by the MRPS27 gene. |
| Alias | LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFR |
Storage & Solubility Information
| Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
| Solubility Information | DMSO: 100 mg/mL (275.89 mM), Sonication is recommended.  H2O: < 1 mg/mL (insoluble or slightly soluble) |
Calculator
In Vivo Formulation Calculator (Clear solution)
Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:
For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . A total of 10 animals were administered, and the formula you used is 5% 
DMSO+30% PEG300+5% Tween 80+60% ddH2O. So your working solution concentration is 2 mg/mL。Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSO (mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.
(mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.Preparation method for in vivo formula: Take 50 μL DMSO main solution, add 300 μLPEG300 mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLddH2O mix well and clarify
main solution, add 300 μLPEG300 mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLddH2O mix well and clarifyFor Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: buy S27 protein acetate | purchase S27 protein acetate | S27 protein acetate cost | order S27 protein acetate
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.