Shopping Cart
- Remove All
- Your shopping cart is currently empty
14-3-3 zeta/delta Protein, Human, Recombinant (His) is expressed in yeast. The accession number is P63104.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $343 | 20 days | |
100 μg | $646 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | 14-3-3 zeta/delta Protein, Human, Recombinant (His) is expressed in yeast. The accession number is P63104. |
Species | Human |
Expression System | P. pastoris (Yeast) |
Tag | C-6xHis |
Accession Number | P63104 |
Synonyms | YWHAZ,Protein kinase C inhibitor protein 1,KCIP-1 |
Amino Acid | AEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
Construction | 1-245 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 20.6 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation. In neurons, regulates spine maturation through the modulation of ARHGEF7 activity. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.