Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

8-oxo-dGTP diphosphatase Protein, E. coli, Recombinant (His & SUMO)

Catalog No. TMPH-00568

8-oxo-dGTP diphosphatase Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.9 kDa and the accession number is P08337.

8-oxo-dGTP diphosphatase Protein, E. coli, Recombinant (His & SUMO)

8-oxo-dGTP diphosphatase Protein, E. coli, Recombinant (His & SUMO)

Catalog No. TMPH-00568
8-oxo-dGTP diphosphatase Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.9 kDa and the accession number is P08337.
Pack SizePriceAvailabilityQuantity
20 μg $36020 days
100 μg $74520 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
8-oxo-dGTP diphosphatase Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.9 kDa and the accession number is P08337.
Species
E. coli
Expression System
E. coli
TagN-6xHis-SUMO
Accession NumberP08337
Amino Acid
MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Construction
1-129 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight30.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Specifically hydrolyzes both 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to the related monophosphates, thereby cleaning up the nucleotide pools and preventing misincorporation of 8-oxoGua into DNA and RNA. It prevents replicational errors by removing an oxidatively damaged form of guanine (8-oxo-dGTP) from DNA and the nucleotide pool. 8-oxo-dGTP can be inserted opposite dA and dC residues of template DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT may also ensure transcriptional fidelity, removing 8-oxo-GTP from the ribonucleotide triphosphate pool. However, due to the lower efficiency of RNA polymerase 8-oxo-GTP incorporation, MutT is probably not a major contributor to transcriptional fidelity. It also hydrolyzes 8-oxo-dGDP and 8-oxo-GDP to their monophosphate form. In vitro, can also use dGTP, dGDP and other various nucleoside di- and triphosphates, with much lower efficiency. Works cooperatively with MutM and MutY to prevent accumulation in the DNA of oxidized guanine residues.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords