Shopping Cart
- Remove All
Your shopping cart is currently empty
AcMNPV Viral cathepsin Protein (His & SUMO)
Catalog No. TMPH-00134
Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. Accumulates within infected cells as an inactive proenzyme (proV-CATH), which is activated by proteolytic cleavage upon cell death. AcMNPV Viral cathepsin Protein (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 39.9 kDa and the accession number is P25783.
AcMNPV Viral cathepsin Protein (His & SUMO)
Catalog No. TMPH-00134
Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. Accumulates within infected cells as an inactive proenzyme (proV-CATH), which is activated by proteolytic cleavage upon cell death. AcMNPV Viral cathepsin Protein (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 39.9 kDa and the accession number is P25783.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $360 | 20 days | |
| 100 μg | $678 | 20 days | |
| 1 mg | $2,300 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. Accumulates within infected cells as an inactive proenzyme (proV-CATH), which is activated by proteolytic cleavage upon cell death. AcMNPV Viral cathepsin Protein (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 39.9 kDa and the accession number is P25783. |
| Species | AcMNPV |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P25783 |
| Synonyms | Viral cathepsin,V-cath,VCATH,Cysteine proteinase |
| Amino Acid | PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY |
| Construction | 113-323 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 39.9 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. Accumulates within infected cells as an inactive proenzyme (proV-CATH), which is activated by proteolytic cleavage upon cell death. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.