Shopping Cart
- Remove All
- Your shopping cart is currently empty
May play an important role in the control of the immune response and during pregnancy. ADAMDEC1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.9 kDa and the accession number is Q9R0X2.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $678 | 20 days | |
1 mg | $2,300 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | May play an important role in the control of the immune response and during pregnancy. ADAMDEC1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.9 kDa and the accession number is Q9R0X2. |
Species | Mouse |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | Q9R0X2 |
Synonyms | ADAM-like protein decysin-1,ADAM DEC1,A disintegrin and metalloproteinase domain-like protein decysin-1 |
Amino Acid | NEDLLQGQKYIGLFLVLDNAYYKLYNGNVTQMRTFLFKVLNLLNMIYKTINIQVSLVGMEIWSDQDKIKVEPNLGATFTHFMRWHYSNLGKRIHNHAQLLSGASFRHGRVGMAAGNSFCTTSSVSVIEAKKKNNVALVALMSHELGHALGMKDVPYYTKCPSGSCVMNQYLSSKFPKDFSTVSRSHFQGFLSSRNARCLLLAPDPKNIIKPTCGNQVLDVGEECDCGSPEECTNLCCEPLTCRLKSQPDCSEASNHITE |
Construction | 209-467 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 34.9 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | May play an important role in the control of the immune response and during pregnancy. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.