Shopping Cart
- Remove All
![TargetMol](https://www.targetmol.com/storage/error/oops.webp)
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $284 | 20 days | |
100 μg | $537 | 20 days | |
1 mg | $2,300 | 20 days |
Description | AK3 Protein, Human, Recombinant (His & Myc) is expressed in E. coli. |
Species | Human |
Expression System | E. coli |
Tag | N-10xHis, C-Myc |
Accession Number | Q9UIJ7 |
Synonyms | Adenylate kinase 3,AK6,AKL3L,Adenylate kinase 3 alpha-like 1,AK3L1,GTP:AMP phosphotransferase AK3, mitochondrial |
Amino Acid | MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP |
Construction | 1-227 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 32.6 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.