Shopping Cart
- Remove All
- Your shopping cart is currently empty
Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.9 kDa and the accession number is P68410.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $491 | 20 days | |
100 μg | $1,370 | 20 days | |
1 mg | $2,750 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.9 kDa and the accession number is P68410. |
Species | Tityus serrulatus |
Expression System | Baculovirus Insect Cells |
Tag | N-10xHis, C-Myc |
Accession Number | P68410 |
Synonyms | TsTX-III,TsTX-II,TsTX III-8,Tst2,Toxin T1-IV,Toxin II,Tityustoxin II,P-Mice-beta* NaTx5.1 |
Amino Acid | KEGYAMDHEGCKFSCFIRPAGFCDGYCKTHLKASSGYCAWPACYCYGVPDHIKVWDYATNKC |
Construction | 1-62 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 10.9 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin acts on Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.5/SCN5A, Nav1.6/SCN8A and Nav1.7/SCN9A voltage-gated sodium channels, with the highest affinity for Nav1.3/SCN3A, followed by Nav1.6/SCN8A and Nav1.7/SCN9A which are affected almost equally. Interestingly, shows a significant shift of the voltage dependence of activation for Nav1.3/SCN3A that is characteristic of beta-toxins. In addition, in presence of LPS, this toxin inhibits the release of NO, IL-6 and TNF-alpha in J774.1 cells. Further, in the absence of LPS, it stimulates the production of the anti-inflammatory cytokine IL-10. This toxin is active on mammals. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.