Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

Alpha-mammal toxin Ts2 Protein, Tityus serrulatus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.9 kDa and the accession number is P68410.

Tityus serrulatus

Baculovirus Insect Cells

TsTX-III,TsTX-II,TsTX III-8,Tst2,Toxin T1-IV,Toxin II,Tityustoxin II,P-Mice-beta* NaTx5.1

KEGYAMDHEGCKFSCFIRPAGFCDGYCKTHLKASSGYCAWPACYCYGVPDHIKVWDYATNKC

1-62 aa

> 85% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin acts on Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.5/SCN5A, Nav1.6/SCN8A and Nav1.7/SCN9A voltage-gated sodium channels, with the highest affinity for Nav1.3/SCN3A, followed by Nav1.6/SCN8A and Nav1.7/SCN9A which are affected almost equally. Interestingly, shows a significant shift of the voltage dependence of activation for Nav1.3/SCN3A that is characteristic of beta-toxins. In addition, in presence of LPS, this toxin inhibits the release of NO, IL-6 and TNF-alpha in J774.1 cells. Further, in the absence of LPS, it stimulates the production of the anti-inflammatory cytokine IL-10. This toxin is active on mammals.