Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His)

Catalog No. TMPH-00034

Virus attachment protein. ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 12.7 kDa and the accession number is P0C9Y3.

ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His)

ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His)

Catalog No. TMPH-00034
Virus attachment protein. ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 12.7 kDa and the accession number is P0C9Y3.
Pack SizePriceAvailabilityQuantity
20 μg$1,50020 days
100 μg$2,50020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Virus attachment protein. ASFV (isolate Tick/South Africa/Pretoriuskop Pr4/1996) p12 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 12.7 kDa and the accession number is P0C9Y3.
Species
ASFV
Expression System
E. coli
TagN-10xHis
Accession NumberP0C9Y3
Synonyms
Protein p12,Pret-110,Inner membrane protein p12
Amino Acid
MALDGSSGGGSNVETLLIVAIIVVIMAIMLYYFWWMPRQQKKCSKAEECTCNNGSCSLKTS
Construction
1-61 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight12.7 kDa (predicted)
FormulationLyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Virus attachment protein.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.