Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Bat coronavirus HKU3 Spike glycoprotein (His)

Catalog No. TMPH-00195

Bat coronavirus HKU3 Spike glycoprotein (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 24.3 kDa and the accession number is Q3LZX1.

Bat coronavirus HKU3 Spike glycoprotein (His)

Bat coronavirus HKU3 Spike glycoprotein (His)

Catalog No. TMPH-00195
Bat coronavirus HKU3 Spike glycoprotein (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 24.3 kDa and the accession number is Q3LZX1.
Pack SizePriceAvailabilityQuantity
20 μg $29420 days
100 μg $89020 days
500 μg $1,29020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Bat coronavirus HKU3 Spike glycoprotein (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 24.3 kDa and the accession number is Q3LZX1.
Species
BtCoV
Expression System
Baculovirus Insect Cells
TagC-6xHis
Accession NumberQ3LZX1
Synonyms
Spike glycoprotein,S glycoprotein,Peplomer protein,E2
Amino Acid
RVSPTQEVIRFPNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTGCVIAWNTAKHDTGNYYYRSHRKTKLKPFERDLSSDDGNGVYTLSTYDFNPNVPVAYQATRVVVLSFELLNAPATVCGPKLSTELVKNQCVNF
Construction
310-514 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight24.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.