BCAN Protein, Rat, Recombinant (His & Myc)

Catalog No. TMPH-03253

May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Isoform 2 may function as a chondroitin sulfate-bearing cell surface receptor. BCAN Protein, Rat, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 19 kDa and the accession number is P55068.

BCAN Protein, Rat, Recombinant (His & Myc)

Catalog No. TMPH-03253

Pack Size	Price	Availability
20 μg	$491	20 days
100 μg	$1,370	20 days
500 μg	$1,960	20 days

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Isoform 2 may function as a chondroitin sulfate-bearing cell surface receptor. BCAN Protein, Rat, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 19 kDa and the accession number is P55068.
Species	Rat
Expression System	Baculovirus Insect Cells
Tag	N-10xHis, C-Myc
Accession Number	P55068
Synonyms	Brevican core protein,Brain-enriched hyaluronan-binding protein,BEHAB,Behab,Bcan
Amino Acid	DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM
Construction	658-786 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	19 kDa (predicted)
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Isoform 2 may function as a chondroitin sulfate-bearing cell surface receptor.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.