Shopping Cart
- Remove All
- Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $397 | 20 days | |
100 μg | $769 | 20 days | |
1 mg | $2,760 | 20 days |
Biological Information | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins. |
Species | E. coli |
Expression System | P. pastoris (Yeast) |
Tag | C-6xHis |
Accession Number | P28585 |
Synonyms | Beta-lactamase MEN-1,Cefotaximase 1,bla,men1,Beta-lactamase CTX-M-1 |
Amino Acid | QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL |
Construction | 29-291 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 30.2 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.