Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Bovine coronavirus (strain 98TXSF-110-ENT) Protein I (His)

Catalog No. TMPH-00254

Structural protein that is not essential for the viral replication either in tissue culture or in its natural host. Bovine coronavirus (strain 98TXSF-110-ENT) Protein I (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 24.0 kDa and the accession number is Q91A21.

Bovine coronavirus (strain 98TXSF-110-ENT) Protein I (His)

Bovine coronavirus (strain 98TXSF-110-ENT) Protein I (His)

Catalog No. TMPH-00254
Structural protein that is not essential for the viral replication either in tissue culture or in its natural host. Bovine coronavirus (strain 98TXSF-110-ENT) Protein I (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 24.0 kDa and the accession number is Q91A21.
Pack SizePriceAvailabilityQuantity
20 μg $19820 days
100 μg $42720 days
1 mg $1,83020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Structural protein that is not essential for the viral replication either in tissue culture or in its natural host. Bovine coronavirus (strain 98TXSF-110-ENT) Protein I (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 24.0 kDa and the accession number is Q91A21.
Species
BCoV
Expression System
E. coli
TagC-6xHis
Accession NumberQ91A21
Synonyms
Protein in nucleocapsid ORF,Protein I,N internal ORF protein,N,IORF,I,Accessory protein N2
Amino Acid
MASLSGPISPTNLEMFKPGVEELNPSKLLLLSNHQEGMLYPTILGSLELLSFKRERSLNLQRDKVCLLHQESQLLKLRGTGTDTTDVPLKQPMATSVNCYHDGIFTILEQDRMPKTSMAPTLTESTGSLVTRLMSIPRLTFSIGTQVAMRLFRLGFRLARYSLRVTILKAQEGLLLIPDLLHAHPVEPLVQDRAVEPILAIEPLPLV
Construction
1-207 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight24.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Structural protein that is not essential for the viral replication either in tissue culture or in its natural host.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.