Shopping Cart
- Remove All
Your shopping cart is currently empty
Bovine coronavirus (strain F15) Nucleoprotein/NP Protein (His)
Catalog No. TMPH-00250
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. Bovine coronavirus (strain F15) Nucleoprotein/NP Protein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 51.7 kDa and the accession number is P19902.
Bovine coronavirus (strain F15) Nucleoprotein/NP Protein (His)
Catalog No. TMPH-00250
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. Bovine coronavirus (strain F15) Nucleoprotein/NP Protein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 51.7 kDa and the accession number is P19902.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $368 | 20 days | |
| 100 μg | $987 | 20 days | |
| 1 mg | $4,340 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. Bovine coronavirus (strain F15) Nucleoprotein/NP Protein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 51.7 kDa and the accession number is P19902. |
| Species | BCoV |
| Expression System | HEK293 Cells |
| Tag | C-6xHis |
| Accession Number | P19902 |
| Synonyms | Protein N,Nucleoprotein,Nucleocapsid protein,NC,N |
| Amino Acid | MSFTPGKQSSSRASSGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTRDGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIVSLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI |
| Construction | 1-448 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 51.7 kDa (predicted) |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.