Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CA5A Protein, Human, Recombinant

Catalog No. TMPH-01038

Reversible hydration of carbon dioxide. Low activity. CA5A Protein, Human, Recombinant is expressed in HEK293 mammalian cells. The predicted molecular weight is 30.6 kDa and the accession number is P35218.

CA5A Protein, Human, Recombinant

CA5A Protein, Human, Recombinant

Catalog No. TMPH-01038
Reversible hydration of carbon dioxide. Low activity. CA5A Protein, Human, Recombinant is expressed in HEK293 mammalian cells. The predicted molecular weight is 30.6 kDa and the accession number is P35218.
Pack SizePriceAvailabilityQuantity
20 μg $39220 days
100 μg $62720 days
1 mg $4,60020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Reversible hydration of carbon dioxide. Low activity. CA5A Protein, Human, Recombinant is expressed in HEK293 mammalian cells. The predicted molecular weight is 30.6 kDa and the accession number is P35218.
Species
Human
Expression System
HEK293 Cells
TagTag Free
Accession NumberP35218
Synonyms
CA-VA,Carbonic anhydrase VA,Carbonic anhydrase 5A, mitochondrial,Carbonate dehydratase VA,CA5A,CA5
Amino Acid
CAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS
Construction
39-305 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight30.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Reversible hydration of carbon dioxide. Low activity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.