The esterase activity is determined to be greater than 500 pmol/min/ug

Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915.

Human

E. coli

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

2-261 aa

>95% as determined by SDS-PAGE.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 6 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.