Shopping Cart
- Remove All
- Your shopping cart is currently empty
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
50 μg | $323 | 20 days | |
500 μg | $2,770 | 20 days | |
1 mg | $3,960 | 20 days |
Biological Activity | The esterase activity is determined to be greater than 500 pmol/min/ug |
Description | Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915. |
Species | Human |
Expression System | E. coli |
Tag | C-6xHis |
Accession Number | P00915 |
Synonyms | Cyanamide hydratase CA1,Carbonic anhydrase I (CA-I),Carbonic anhydrase B (CAB),Carbonic anhydrase 1,Carbonate dehydratase I,CA1 |
Amino Acid | ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
Construction | 2-261 aa |
Protein Purity | >95% as determined by SDS-PAGE. |
Molecular Weight | 29.93 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0 |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.