Shopping Cart
- Remove All
Your shopping cart is currently empty
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His)
Catalog No. TMPH-03829
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915.
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His)
Catalog No. TMPH-03829
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 50 μg | $323 | 20 days | |
| 500 μg | $2,770 | 20 days | |
| 1 mg | $3,960 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | The esterase activity is determined to be greater than 500 pmol/min/ug |
| Description | Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | P00915 |
| Synonyms | Cyanamide hydratase CA1,Carbonic anhydrase I (CA-I),Carbonic anhydrase B (CAB),Carbonic anhydrase 1,Carbonate dehydratase I,CA1 |
| Amino Acid | ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
| Construction | 2-261 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 29.93 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0 |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.