Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. CEACAM4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 14.7 kDa and the accession number is O75871.

Human

P. pastoris (Yeast)

CEACAM4,CGM7,Carcinoembryonic antigen CGM7,CEA cell adhesion molecule 4,Non-specific cross-reacting antigen W236,Carcinoembryonic antigen-related cell adhesion molecule 4

FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG

36-155 aa

> 90% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.