Shopping Cart
- Remove All
![TargetMol](https://newstatic.targetmol.com/error/oops.webp)
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $678 | 20 days | |
1 mg | $2,300 | 20 days |
Description | Weak inhibitor of trypsin. Conglutin-7 Protein, Arachis hypogaea, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is Q6PSU2. |
Species | Arachis hypogaea |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | Q6PSU2 |
Synonyms | 2S protein 1,Conglutin-7,Seed storage protein SSP2,Ara h 2,Seed storage protein SSP1 |
Amino Acid | RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY |
Construction | 22-172 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 22.0 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Weak inhibitor of trypsin. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.