Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His)

Catalog No. TMPH-00179

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370.

Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His)

Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His)

Catalog No. TMPH-00179
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370.
Pack SizePriceAvailabilityQuantity
20 μg$39720 days
100 μg$76920 days
1 mg$2,76020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ab Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P0A370.
Species
Bacillus thuringiensis subsp. kurstaki
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP0A370
Synonyms
Pesticidal crystal protein Cry1Ab,Insecticidal delta-endotoxin CryIA(b),Crystaline entomocidal protoxin,cryIC1,cryIA(b),cry1Ab,cry1A(b),cry-1-2,bt2,130 kDa crystal protein
Amino Acid
HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Construction
1022-1155 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight17.3 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.