Shopping Cart
- Remove All
- Your shopping cart is currently empty
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects. Cry1Fb Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.3 kDa and the accession number is O66377.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $284 | 20 days | |
100 μg | $537 | 20 days | |
1 mg | $2,300 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects. Cry1Fb Protein, Bacillus thuringiensis subsp., Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.3 kDa and the accession number is O66377. |
Species | Bacillus thuringiensis subsp. morrisoni |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | O66377 |
Synonyms | Pesticidal crystal protein Cry1Fb,Insecticidal delta-endotoxin CryIF(b),Crystaline entomocidal protoxin,cryINA67-1,cryIF(b),cry1Fb,132 kDa crystal protein |
Amino Acid | VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE |
Construction | 984-1169 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 26.3 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.