Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CSL3 Protein, Oncorhynchus keta, Recombinant (His)

Catalog No. TMPH-03069

L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.

CSL3 Protein, Oncorhynchus keta, Recombinant (His)

CSL3 Protein, Oncorhynchus keta, Recombinant (His)

Catalog No. TMPH-03069
L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.
Pack SizePriceAvailabilityQuantity
20 μg $36020 days
100 μg $74520 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.
Species
Oncorhynchus keta
Expression System
E. coli
TagN-10xHis
Accession NumberP86179
Synonyms
L-rhamnose-binding lectin CSL3
Amino Acid
AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD
Construction
1-195 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight27.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.