Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CT83 Protein-VLP, Human, Recombinant (His)

Catalog No. TMPH-01594

CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.

CT83 Protein-VLP, Human, Recombinant (His)

CT83 Protein-VLP, Human, Recombinant (His)

Catalog No. TMPH-01594
CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.
Pack SizePriceAvailabilityQuantity
20 μg $81520 days
100 μg $1,96020 days
1 mg $10,80020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CT83 Protein-VLP, Human, Recombinant (His) is expressed in HEK293.
Species
Human
Expression System
HEK293 Cells
TagN-6xHis(This tag can be tested only under denaturing conditions)
Accession NumberQ5H943
Amino Acid
MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Construction
1-113 aa
Molecular Weight14.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationPBS, pH 7.4, 6% trehalose
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords