Shopping Cart
- Remove All
- Your shopping cart is currently empty
CTAG1A Protein, Human, Recombinant (hFc & Myc) is expressed in HEK293 mammalian cells with C-hFc-Myc tag. The predicted molecular weight is 48.1 kDa and the accession number is P78358.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $614 | 20 days | |
100 μg | $1,890 | 20 days | |
500 μg | $5,680 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | CTAG1A Protein, Human, Recombinant (hFc & Myc) is expressed in HEK293 mammalian cells with C-hFc-Myc tag. The predicted molecular weight is 48.1 kDa and the accession number is P78358. |
Species | Human |
Expression System | HEK293 Cells |
Tag | C-hFc-Myc |
Accession Number | P78358 |
Synonyms | LAGE2B,LAGE2A,LAGE-2,LAGE2,L antigen family member 2,ESO1,CTAG1B,CTAG1A,CTAG1,CTAG,CT6.1,Cancer/testis antigen 6.1,Cancer/testis antigen 1,Autoimmunogenic cancer/testis antigen NY-ESO-1 |
Amino Acid | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR |
Construction | 1-180 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 48.1 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.