Shopping Cart
- Remove All
Your shopping cart is currently empty
Cystatin-14 Protein, Mouse, Recombinant (His)
Catalog No. TMPH-04255
Cystatin-14 Protein, Mouse, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q8VII3.
Cystatin-14 Protein, Mouse, Recombinant (His)
Catalog No. TMPH-04255
Cystatin-14 Protein, Mouse, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q8VII3.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $360 | 20 days | |
| 100 μg | $678 | 20 days | |
| 1 mg | $2,300 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity testing is in progress. It is theoretically active, but we cannot guarantee it. |
| Description | Cystatin-14 Protein, Mouse, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q8VII3. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | Q8VII3 |
| Synonyms | Cystatin-14,Cystatin SC,Cst14 |
| Amino Acid | INKEFLDVTKDLDYFVASVEFAVAQFNDNNPEENTYKLLEVGRAQKKTWTMIFLMDLEMGRTICKKHDENIHNCPLLQGSREKKVHCVFQVDARPWFSHFTILTSTCVPT |
| Construction | 21-130 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 19.7 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.