Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

FAM167A Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01935

FAM167A Protein, Human, Recombinant (His & Myc) is expressed in HEK293.

FAM167A Protein, Human, Recombinant (His & Myc)

FAM167A Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01935
FAM167A Protein, Human, Recombinant (His & Myc) is expressed in HEK293.
Pack SizePriceAvailabilityQuantity
20 μg$61420 days
100 μg$1,72020 days
500 μg$5,17020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
FAM167A Protein, Human, Recombinant (His & Myc) is expressed in HEK293.
Species
Human
Expression System
HEK293 Cells
TagN-10xHis, C-Myc
Accession NumberQ96KS9
Synonyms
Protein FAM167A,FAM167A
Amino Acid
MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC
Construction
1-214 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight28.2 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
N/A

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.