FAM174A Protein, Human, Recombinant (His)

Catalog No. TMPZ-00003

FAM174A Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 10.34 kDa and the accession number is Q8TBP5.

FAM174A Protein, Human, Recombinant (His)

Catalog No. TMPZ-00003

FAM174A Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 10.34 kDa and the accession number is Q8TBP5.

Pack Size	Price	Availability	Quantity

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	FAM174A Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 10.34 kDa and the accession number is Q8TBP5.
Species	Human
Expression System	HEK295 Cells
Tag	N-His
Accession Number	Q8TBP5
Synonyms	Transmembrane protein 157,TMEM157,NS5ATP6,FAM174A
Amino Acid	LAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQR
Construction	A DNA sequence encoding the human FAM174A (30Leu - 123Arg) was expressed with a polyhistidine tag at the N-terminus.
Protein Purity	> 90 % as determined by SDS-PAGE.
Molecular Weight	10.34 kDa (Predicted)
Endotoxin	< 1.0 EU per μg protein as determined by the LAL method.
Formulation	Supplied as sterile solution in PBS, pH 7.4.
Stability & Storage	Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Shipping	Shipping with dry-ice

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

FAM174AProtein,Human,Recombinant(His)