Shopping Cart
- Remove All
- Your shopping cart is currently empty
FAM174A Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 10.34 kDa and the accession number is Q8TBP5.
Pack Size | Price | Availability | Quantity |
---|
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | FAM174A Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 10.34 kDa and the accession number is Q8TBP5. |
Species | Human |
Expression System | HEK295 Cells |
Tag | N-His |
Accession Number | Q8TBP5 |
Synonyms | Transmembrane protein 157,TMEM157,NS5ATP6,FAM174A |
Amino Acid | LAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQR |
Construction | A DNA sequence encoding the human FAM174A (30Leu - 123Arg) was expressed with a polyhistidine tag at the N-terminus. |
Protein Purity | > 90 % as determined by SDS-PAGE. |
Molecular Weight | 10.34 kDa (Predicted) |
Endotoxin | < 1.0 EU per μg protein as determined by the LAL method. |
Formulation | Supplied as sterile solution in PBS, pH 7.4. |
Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Shipping | Shipping with dry-ice |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.