Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

GH2 Protein, Human, Recombinant (His)

Catalog No. TMPZ-00002

GH2 Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
GH2 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 21.01 kDa and the accession number is P01242.

GH2 Protein, Human, Recombinant (His)

GH2 Protein, Human, Recombinant (His)

Catalog No. TMPZ-00002
GH2 Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. GH2 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 21.01 kDa and the accession number is P01242.
Pack SizePriceAvailabilityQuantity
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
GH2 Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues._x000D_ GH2 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 21.01 kDa and the accession number is P01242.
Species
Human
Expression System
HEK294 Cells
TagN-His
Accession NumberP01242
Synonyms
Placenta-specific growth hormone,Growth hormone 2
Amino Acid
FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Construction
A DNA sequence encoding the human GH2 (27Phe - 217Phe) was expressed with a polyhistidine tag at the N-terminus.
Protein Purity
> 90 % as determined by SDS-PAGE.
Molecular Weight21.01 kDa (Predicted)
Endotoxin< 1.0 EU per μg protein as determined by the LAL method.
FormulationSupplied as sterile solution in PBS, pH 7.4.
Stability & Storage
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
ShippingShipping with dry-ice
Research Background
GH2 Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords