Shopping Cart
- Remove All
- Your shopping cart is currently empty
GH2 Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
GH2 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 21.01 kDa and the accession number is P01242.
Pack Size | Price | Availability | Quantity |
---|
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | GH2 Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues._x000D_
GH2 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 21.01 kDa and the accession number is P01242. |
Species | Human |
Expression System | HEK294 Cells |
Tag | N-His |
Accession Number | P01242 |
Synonyms | Placenta-specific growth hormone,Growth hormone 2 |
Amino Acid | FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
Construction | A DNA sequence encoding the human GH2 (27Phe - 217Phe) was expressed with a polyhistidine tag at the N-terminus. |
Protein Purity | > 90 % as determined by SDS-PAGE. |
Molecular Weight | 21.01 kDa (Predicted) |
Endotoxin | < 1.0 EU per μg protein as determined by the LAL method. |
Formulation | Supplied as sterile solution in PBS, pH 7.4. |
Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Shipping | Shipping with dry-ice |
Research Background | GH2 Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.