Shopping Cart
- Remove All
Your shopping cart is currently empty
GIPR Protein, Human, Recombinant (His & Myc)
Catalog No. TMPH-01378
This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. GIPR Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 18.5 kDa and the accession number is P48546.
GIPR Protein, Human, Recombinant (His & Myc)
Catalog No. TMPH-01378
This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. GIPR Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 18.5 kDa and the accession number is P48546.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $614 | 20 days | |
| 100 μg | $1,720 | 20 days | |
| 1 mg | $7,240 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. GIPR Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 18.5 kDa and the accession number is P48546. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | N-10xHis, C-Myc |
| Accession Number | P48546 |
| Synonyms | Glucose-dependent insulinotropic polypeptide receptor,GIPR,Gastric inhibitory polypeptide receptor |
| Amino Acid | RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ |
| Construction | 22-138 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 18.5 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.