Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Glycodelin Protein, Human, Recombinant (His)

Catalog No. TMPH-01401

Glycodelin Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 22.4 kDa and the accession number is P09466.

Glycodelin Protein, Human, Recombinant (His)

Glycodelin Protein, Human, Recombinant (His)

Catalog No. TMPH-01401
Glycodelin Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 22.4 kDa and the accession number is P09466.
Pack SizePriceAvailabilityQuantity
20 μg $19820 days
100 μg $42720 days
1 mg $1,83020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Glycodelin Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 22.4 kDa and the accession number is P09466.
Species
Human
Expression System
E. coli
TagN-10xHis
Accession NumberP09466
Synonyms
Zona-binding inhibitory factor-1,Progesterone-associated endometrial protein,Progestagen-associated endometrial protein,Pregnancy-associated endometrial alpha-2 globulin,Placental protein 14,PAEP,Glycodelin
Amino Acid
MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Construction
19-180 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight22.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities. Glycodelin-C stimulates binding of spermatozoa to the zona pellucida. Glycodelin-F inhibits spermatozoa-zona pellucida binding and significantly suppresses progesterone-induced acrosome reaction of spermatozoa. Glycodelin-S in seminal plasma maintains the uncapacitated state of human spermatozoa.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.