Shopping Cart
- Remove All
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $397 | 20 days | |
100 μg | $769 | 20 days | |
1 mg | $2,760 | 20 days |
Description | Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His) is expressed in Yeast. |
Species | Canine |
Expression System | P. pastoris (Yeast) |
Tag | C-10xHis |
Accession Number | Q9XSW8 |
Synonyms | Follicle-stimulating hormone alpha chain,Glycoprotein hormones alpha chain,Lutropin alpha chain,Luteinizing hormone alpha chain,Follitropin alpha chain,Thyroid-stimulating hormone alpha chain,CGA,Thyrotropin alpha chain,Anterior pituitary glycoprotein hormones common subunit alpha |
Amino Acid | FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS |
Construction | 25-120 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 12.7 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.