Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

GSTA1 Protein, Rat, Recombinant (His & SUMO)

Catalog No. TMPH-03305

GSTA1 Protein, Rat, Recombinant (His & SUMO) is expressed in E. coli.

GSTA1 Protein, Rat, Recombinant (His & SUMO)

GSTA1 Protein, Rat, Recombinant (His & SUMO)

Catalog No. TMPH-03305
GSTA1 Protein, Rat, Recombinant (His & SUMO) is expressed in E. coli.
Pack SizePriceAvailabilityQuantity
20 μg$28420 days
100 μg$53720 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
GSTA1 Protein, Rat, Recombinant (His & SUMO) is expressed in E. coli.
Species
Rat
Expression System
E. coli
TagN-6xHis-SUMO
Accession NumberP00502
Synonyms
Ligandin,Gsta1,GST B,GST A1-1,GST 1a-1a,GST 1-1,Glutathione S-transferase Ya-1,Glutathione S-transferase alpha-1,Androst-5-ene-3,17-dione isomerase,13-hydroperoxyoctadecadienoate peroxidase
Amino Acid
SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
Construction
2-222 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight41.5 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Glutathione S-transferase that catalyzes the nucleophilic attack of the sulfur atom of glutathione on the electrophilic groups of a wide range of exogenous and endogenous compounds (Probable). Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). It also catalyzes the isomerization of D5-androstene-3,17-dione (AD) into D4-androstene-3,17-dione and may therefore play an important role in hormone biosynthesis. Through its glutathione-dependent peroxidase activity toward the fatty acid hydroperoxide (13S)-hydroperoxy-(9Z,11E)-octadecadienoate/13-HPODE it is also involved in the metabolism of oxidized linoleic acid.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.