Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Heat-labile enterotoxin A chain Protein, E. coli, Recombinant (His & Myc)

Catalog No. TMPH-00630

The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.

Heat-labile enterotoxin A chain Protein, E. coli, Recombinant (His & Myc)

Heat-labile enterotoxin A chain Protein, E. coli, Recombinant (His & Myc)

Catalog No. TMPH-00630
The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Pack SizePriceAvailabilityQuantity
20 μg $28420 days
100 μg $59020 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Species
E. coli
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP06717
Synonyms
LTP-A,LT-A, porcine,Heat-labile enterotoxin A chain,eltA
Amino Acid
NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Construction
19-258 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight32.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.